Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPHK1 Peptide - C-terminal region

SPHK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPHK

UniProt

Q9NYA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPHK1 Rabbit Polyclonal Antibody (orb589614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001136073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse E-Cadherin/CDH1 Protein (His Tag)
PKSM040553 100 µg

Recombinant Mouse E-Cadherin/CDH1 Protein (His Tag)

Sign In for Pricing
View Details
Octafluorocyclopentene
TRC-O273120-1G 1 g

Octafluorocyclopentene

Sign In for Pricing
View Details
Human ZNF674 activation kit by CRISPRa
GA118651 1 Kit

Human ZNF674 activation kit by CRISPRa

Sign In for Pricing
View Details
Diclofenac Acid
TRC-D436465-1G 1 g

Diclofenac Acid

Sign In for Pricing
View Details
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B1]
TA805313AM 100 µL

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B1]

Sign In for Pricing
View Details
EPHB1/2/3 Antibody
8C15651-AAT 50 µg

EPHB1/2/3 Antibody

Sign In for Pricing
View Details