Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL12B Peptide - middle region

IL12B Peptide - middle region

Product Specifications

Product Name Alternative

CLMF, NKSF, CLMF2, IMD28, IMD29, NKSF2, IL-12B

UniProt

P29460

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL12B Rabbit Polyclonal Antibody (orb589619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002178.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZEB1/NIL2A Rabbit Polyclonal Antibody (AP)
orb1599324 100 µL

ZEB1/NIL2A Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
EMID2 Protein Vector (Human) (pPB-N-His)
PV051666 500 ng

EMID2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Idp1 Antibody
orb854673 2 mg

Idp1 Antibody

Sign In for Pricing
View Details
PCSK9 Recombinant Rabbit mAb
E43S45287 100 µL

PCSK9 Recombinant Rabbit mAb

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)
MBS2147845-01 0.1 mL

APC-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)
MBS2147845-02 0.2 mL

APC-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)

Sign In for Pricing
View Details