Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL12B Peptide - middle region

IL12B Peptide - middle region

Product Specifications

Product Name Alternative

CLMF, NKSF, CLMF2, IMD28, IMD29, NKSF2, IL-12B

UniProt

P29460

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL12B Rabbit Polyclonal Antibody (orb589619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002178.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt5 Mouse shRNA Plasmid (Locus ID 110308)
TR509208 1 Kit

Krt5 Mouse shRNA Plasmid (Locus ID 110308)

Sign In for Pricing
View Details
PURA (Purine-Rich Element Binding Protein A, PUR-ALPHA, PUR1, PURALPHA) (AP) discontinued
250735-AP 100 µL

PURA (Purine-Rich Element Binding Protein A, PUR-ALPHA, PUR1, PURALPHA) (AP) discontinued

Sign In for Pricing
View Details
Anti-CNPase Antibody Picoband® (HRP Conjugate)
A01017-HRP 100 µg/Vial

Anti-CNPase Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Ptpn11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4645405 3x 1.0 µg

Ptpn11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Annexin VI Rabbit pAb, BF700 conjugated
orb2883029 100 µL

Annexin VI Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
FMO5 siRNA (Human)
orb1866625-01 15 nmol

FMO5 siRNA (Human)

Sign In for Pricing
View Details