Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1C Peptide - middle region

CDKN1C Peptide - middle region

Product Specifications

Product Name Alternative

BWS, WBS, p57, BWCR, KIP2, p57Kip2

UniProt

P49918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKN1C Rabbit Polyclonal Antibody (orb589622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000067.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit CDC6 IHC Antibody
orb1517586-01 10 µL

Rabbit CDC6 IHC Antibody

Sign In for Pricing
View Details
Rabbit CDC6 IHC Antibody
orb1517586-02 100 µL

Rabbit CDC6 IHC Antibody

Sign In for Pricing
View Details
MUC4 siRNA (Human)
orb1865237-01 15 nmol

MUC4 siRNA (Human)

Sign In for Pricing
View Details
MUC4 siRNA (Human)
orb1865237-02 30 nmol

MUC4 siRNA (Human)

Sign In for Pricing
View Details
NSC 405020
MBS575642 Inquire

NSC 405020

Sign In for Pricing
View Details
CCT4, NT (CCT4, CCTD, SRB, T-complex protein 1 subunit delta, CCT-delta, Stimulator of TAR RNA-binding) (Biotin) discontinued
033437-Biotin 200 µL

CCT4, NT (CCT4, CCTD, SRB, T-complex protein 1 subunit delta, CCT-delta, Stimulator of TAR RNA-binding) (Biotin) discontinued

Sign In for Pricing
View Details