Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALCAM Peptide - middle region

ALCAM Peptide - middle region

Product Specifications

Product Name Alternative

MEMD, CD166

UniProt

Q13740

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALCAM Rabbit Polyclonal Antibody (orb589629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001230209.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS629465 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS706757 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) (C-term) Rabbit Polyclonal Antibody
AP50176PU-N 400 µL

Angiopoietin 2 (ANGPT2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(R)-Norfenfluramine Hydrochloride
TRC-N680985-50MG 50 mg

(R)-Norfenfluramine Hydrochloride

Sign In for Pricing
View Details
Human MUC4 (Mucin 4) CLIA Kit
E-CL-H0519-01 24 Tests

Human MUC4 (Mucin 4) CLIA Kit

Sign In for Pricing
View Details
Human MUC4 (Mucin 4) CLIA Kit
E-CL-H0519-02 48 Tests

Human MUC4 (Mucin 4) CLIA Kit

Sign In for Pricing
View Details