ALCAM Peptide - middle region
ALCAM Peptide - middle region
Product Specifications
Product Name Alternative
MEMD, CD166
UniProt
Q13740
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ALCAM Rabbit Polyclonal Antibody (orb589629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001230209.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH034165-01 20 µg
Recombinant Human/Mouse/Rat Activin A protein (His Tag)
Sign In for Pricing
View Details PKSH034165-02 100 µg
Recombinant Human/Mouse/Rat Activin A protein (His Tag)
Sign In for Pricing
View Details 
PKSH030732 100 µg
Recombinant Human TXNRD1/TRXR1 Protein (aa 161-647, His Tag)
Sign In for Pricing
View Details 
BNC472480-500 1x 500 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details