Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TKFC Peptide - middle region

TKFC Peptide - middle region

Product Specifications

Product Name Alternative

DAK, NET45

UniProt

Q3LXA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TKFC Rabbit Polyclonal Antibody (orb589754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056348.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MINDY4 Antibody Picoband®, HRP Conjugate
A32449-1-HRP 100 µg/Vial

Anti-MINDY4 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
RDX (Radixin, DFNB24) (PE)
MBS6183765-01 0.1 mL

RDX (Radixin, DFNB24) (PE)

Sign In for Pricing
View Details
RDX (Radixin, DFNB24) (PE)
MBS6183765-02 5x 0.1 mL

RDX (Radixin, DFNB24) (PE)

Sign In for Pricing
View Details
DNAJA2 Polyclonal Antibody
MBS9433939-01 0.05 mL

DNAJA2 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA2 Polyclonal Antibody
MBS9433939-02 0.1 mL

DNAJA2 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA2 Polyclonal Antibody
MBS9433939-03 5x 0.1 mL

DNAJA2 Polyclonal Antibody

Sign In for Pricing
View Details