Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TKFC Peptide - middle region

TKFC Peptide - middle region

Product Specifications

Product Name Alternative

DAK, NET45

UniProt

Q3LXA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TKFC Rabbit Polyclonal Antibody (orb589754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056348.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700055N04Rik Recombinant Protein (Mouse)
RP110459 100 µg

1700055N04Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
MBS2580771-01 0.02 mg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
MBS2580771-02 0.1 mg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
MBS2580771-03 5x 0.1 mg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details
PLGA (1.8K) -PEG-COOH, 10K
HE083017-10K Inquire

PLGA (1.8K) -PEG-COOH, 10K

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Heat Shock Protein Beta 9 (HSPb9)
MBS2136867-01 0.1 mL

HRP Linked Polyclonal Antibody to Heat Shock Protein Beta 9 (HSPb9)

Sign In for Pricing
View Details