CDK2AP1 Peptide - middle region
CDK2AP1 Peptide - middle region
Product Specifications
Product Name Alternative
DOC1, ST19, DORC1, doc-1, p12DOC-1
UniProt
O14519
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK2AP1 Rabbit Polyclonal Antibody (orb588702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001257362.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA700523 50 µg
SSB Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1E11]
Sign In for Pricing
View Details 
ARP35459_T100-HRP 100 µL
KCNQ2 Antibody - middle region : HRP (ARP35459_T100-HRP)
Sign In for Pricing
View Details