Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE11A Peptide - N-terminal region

PDE11A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPNAD2

UniProt

Q9HCR9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE11A Rabbit Polyclonal Antibody (orb589813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001070664.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIA
063-27 100 µg

PIA

Sign In for Pricing
View Details
Mouse TLR4 Recombinant Protein (N-His)
MT205012-01 50 µg

Mouse TLR4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse TLR4 Recombinant Protein (N-His)
MT205012-02 100 µg

Mouse TLR4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse TLR4 Recombinant Protein (N-His)
MT205012-03 1 mg

Mouse TLR4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
ACAD11 Protein Vector (Human) (pPM-C-HA)
11136021 500 ng

ACAD11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PTPN18 Antibody
A66258-100UL 100 µL

PTPN18 Antibody

Sign In for Pricing
View Details