Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE11A Peptide - N-terminal region

PDE11A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPNAD2

UniProt

Q9HCR9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE11A Rabbit Polyclonal Antibody (orb589813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001070664.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human COP1 Protein - (Dry Ice)
H00064326-Q01-10ug 10 µg

Recombinant Human COP1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-ST6GALNAC4 Antibody Picoband®, Dylight550 Conjugate
A11941-1-Dylight550 100 µg

Anti-ST6GALNAC4 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
CHURC 1 (CHURC1) (NM_145165) Human Untagged Clone
SC100095 10 µg

CHURC 1 (CHURC1) (NM_145165) Human Untagged Clone

Sign In for Pricing
View Details
KCNRG rabbit pAb
UB-GEN-9887 100 µL

KCNRG rabbit pAb

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rpsK Protein (aa 1-134) (strain 232)
VAng-Lsx06638-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rpsK Protein (aa 1-134) (strain 232)

Sign In for Pricing
View Details
Rat Parathyroid hormone-related protein,PTHLH ELISA KIT
JOT-EK0932Ra-01 96 Well

Rat Parathyroid hormone-related protein,PTHLH ELISA KIT

Sign In for Pricing
View Details