RASSF2 Peptide - middle region
RASSF2 Peptide - middle region
Product Specifications
Product Name Alternative
CENP-34, RASFADIN
UniProt
P50749
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASSF2 Rabbit Polyclonal Antibody (orb589817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055552.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AL1171A-01 500 mL
RPMI-1640 w/ 1mM Sodium pyruvate, 2mM L-Glutamine 4.5 gms Glucose per litre, 10mM HEPES buffer and Sodium bicarbonate w/o Phenol red
Sign In for Pricing
View Details AL1171A-02 2x 500 mL
RPMI-1640 w/ 1mM Sodium pyruvate, 2mM L-Glutamine 4.5 gms Glucose per litre, 10mM HEPES buffer and Sodium bicarbonate w/o Phenol red
Sign In for Pricing
View Details AL1171A-03 5x 100 mL
RPMI-1640 w/ 1mM Sodium pyruvate, 2mM L-Glutamine 4.5 gms Glucose per litre, 10mM HEPES buffer and Sodium bicarbonate w/o Phenol red
Sign In for Pricing
View Details AL1171A-04 6x 500 mL
RPMI-1640 w/ 1mM Sodium pyruvate, 2mM L-Glutamine 4.5 gms Glucose per litre, 10mM HEPES buffer and Sodium bicarbonate w/o Phenol red
Sign In for Pricing
View Details AL1171A-05 20x 500 mL
RPMI-1640 w/ 1mM Sodium pyruvate, 2mM L-Glutamine 4.5 gms Glucose per litre, 10mM HEPES buffer and Sodium bicarbonate w/o Phenol red
Sign In for Pricing
View Details 
bs-5659R-PE 100 µL
Phospho-RAD9 (Tyr28) Polyclonal Antibody, PE Conjugated
Sign In for Pricing
View Details