Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF2 Peptide - middle region

RASSF2 Peptide - middle region

Product Specifications

Product Name Alternative

CENP-34, RASFADIN

UniProt

P50749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF2 Rabbit Polyclonal Antibody (orb589817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055552.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cphx1 (NM_175342) Mouse Tagged ORF Clone Lentiviral Particle
MR223511L4V 200 µL

Cphx1 (NM_175342) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-ASH2L Antibody
MBS8306067-01 0.03 mL

Anti-ASH2L Antibody

Sign In for Pricing
View Details
Anti-ASH2L Antibody
MBS8306067-02 0.05 mL

Anti-ASH2L Antibody

Sign In for Pricing
View Details
Anti-ASH2L Antibody
MBS8306067-03 0.1 mL

Anti-ASH2L Antibody

Sign In for Pricing
View Details
Anti-ASH2L Antibody
MBS8306067-04 0.2 mL

Anti-ASH2L Antibody

Sign In for Pricing
View Details
Anti-ASH2L Antibody
MBS8306067-05 5x 0.2 mL

Anti-ASH2L Antibody

Sign In for Pricing
View Details