Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPG7 Peptide - N-terminal region

SPG7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAR, PGN, CMAR, SPG5C

UniProt

Q9UQ90

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPG7 Rabbit Polyclonal Antibody (orb589825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003110.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWQLLGGTFYFNTSRLKQKNKEKDKSKGKAPEEDEEERRRRERDDQMYRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (rSPN/839), 0.2mg/mL
BNUB2220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), 0.2mg/mL

Sign In for Pricing
View Details
RPC62 (POLR3C) (NM_001303456) Human Tagged ORF Clone
RG238843 10 µg

RPC62 (POLR3C) (NM_001303456) Human Tagged ORF Clone

Sign In for Pricing
View Details
COX7B Human Gene Knockout Kit (CRISPR)
KN401999 1 Kit

COX7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C12orf50 activation kit by CRISPRa
GA116002 1 Kit

Human C12orf50 activation kit by CRISPRa

Sign In for Pricing
View Details
LOX Recombinant Rabbit Monoclonal Antibody [JU30-23]
ET1706-31 100 µL

LOX Recombinant Rabbit Monoclonal Antibody [JU30-23]

Sign In for Pricing
View Details
Bcl-x (BX006), 0.2mg/mL
BNUB0006-100 1x 100 µL

Bcl-x (BX006), 0.2mg/mL

Sign In for Pricing
View Details