Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPG7 Peptide - N-terminal region

SPG7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAR, PGN, CMAR, SPG5C

UniProt

Q9UQ90

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPG7 Rabbit Polyclonal Antibody (orb589825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003110.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWQLLGGTFYFNTSRLKQKNKEKDKSKGKAPEEDEEERRRRERDDQMYRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL
BNC941461-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinyl Propionate (Stabilized with BHT) 90%
TRC-R275550-5G 5 g

Retinyl Propionate (Stabilized with BHT) 90%

Sign In for Pricing
View Details
Viva 2-Steps RT-PCR Kit with M-MULV RT / Chromo Taq DNA Polymerase, 100app
RTPL16 100 Apps

Viva 2-Steps RT-PCR Kit with M-MULV RT / Chromo Taq DNA Polymerase, 100app

Sign In for Pricing
View Details
4,4'-Diaminodiphenylamine Sulfate Hydrate
TRC-D416300-1G 1 g

4,4'-Diaminodiphenylamine Sulfate Hydrate

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31958-01 50 μL

MHC Class I Antibody

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31958-02 100 µL

MHC Class I Antibody

Sign In for Pricing
View Details