Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAGLU Peptide - C-terminal region

NAGLU Peptide - C-terminal region

Product Specifications

Product Name Alternative

NAG, MPS3B, UFHSD, MPS-IIIB

UniProt

Q14769

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAGLU Rabbit Polyclonal Antibody (orb589829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000254.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO46 (NM_001080469) Human Over-expression Lysate
LC420726 20 µg

FBXO46 (NM_001080469) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene A Br
HA25031501.100G 100 g

Polystyrene A Br

Sign In for Pricing
View Details
Deoxyribonuclease I (DNase I) - for RNA work, 100kU
PC0719-100KU 100 KU

Deoxyribonuclease I (DNase I) - for RNA work, 100kU

Sign In for Pricing
View Details
MAGEA4 (NM_001011548) Human Over-expression Lysate
LY425301 100 µg

MAGEA4 (NM_001011548) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 4-Amino-3-hydroxybenzoate
TRC-E898320-1G 1 g

Ethyl 4-Amino-3-hydroxybenzoate

Sign In for Pricing
View Details
Recombinant p95 Antibody
RC-4878-01 50 μL

Recombinant p95 Antibody

Sign In for Pricing
View Details