BIN2 Peptide - middle region
BIN2 Peptide - middle region
Product Specifications
Product Name Alternative
BRAP-1
UniProt
Q9UBW5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BIN2 Rabbit Polyclonal Antibody (orb589830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001276936.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEVSPNPEPPEKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGE
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1048456-01 100 mg
Trans-Methyl 4- (benzyloxy) cyclohexanecarboxylate
Sign In for Pricing
View Details OR1048456-02 250 mg
Trans-Methyl 4- (benzyloxy) cyclohexanecarboxylate
Sign In for Pricing
View Details