Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD3 Peptide - middle region

STARD3 Peptide - middle region

Product Specifications

Product Name Alternative

CAB1, es64, MLN64

UniProt

Q14849

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD3 Rabbit Polyclonal Antibody (orb589901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001159409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOS ligand Recombinant Antibody, Cy5 Conjugated
bsm-62784R-Cy5-01 20 µL

ICOS ligand Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ICOS ligand Recombinant Antibody, Cy5 Conjugated
bsm-62784R-Cy5-02 100 µL

ICOS ligand Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Kv1.8 Antibody
MBS9629275-01 0.1 mL

Kv1.8 Antibody

Sign In for Pricing
View Details
Kv1.8 Antibody
MBS9629275-02 0.2 mL

Kv1.8 Antibody

Sign In for Pricing
View Details
Kv1.8 Antibody
MBS9629275-03 5x 0.2 mL

Kv1.8 Antibody

Sign In for Pricing
View Details
PTEN, phosphorylated (S380/T382/T383) discontinued
340970-01 100 µL

PTEN, phosphorylated (S380/T382/T383) discontinued

Sign In for Pricing
View Details