Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD3 Peptide - middle region

STARD3 Peptide - middle region

Product Specifications

Product Name Alternative

CAB1, es64, MLN64

UniProt

Q14849

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD3 Rabbit Polyclonal Antibody (orb589901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001159409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pfdn6 (NM_010385) AAV Particle
MR200682A1V 250 µL

Mouse Pfdn6 (NM_010385) AAV Particle

Sign In for Pricing
View Details
ACADM Recombinant Antibody, PE Conjugated
bsm-63329R-PE 100 µL

ACADM Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Ethyl 5-acetyl-2-phenylthiazole-4-carboxylate
OR346087 1 Each

Ethyl 5-acetyl-2-phenylthiazole-4-carboxylate

Sign In for Pricing
View Details
Tdpoz4 Mouse siRNA Oligo Duplex (Locus ID 399675)
SR412451 1 Kit

Tdpoz4 Mouse siRNA Oligo Duplex (Locus ID 399675)

Sign In for Pricing
View Details
TMUB1 (NM_001136044) Human Recombinant Protein
TP327179L 1 mg

TMUB1 (NM_001136044) Human Recombinant Protein

Sign In for Pricing
View Details
Human LTA4H (Leukotriene A4 Hydrolase) ELISA Kit
ELK3336-01 48 Tests

Human LTA4H (Leukotriene A4 Hydrolase) ELISA Kit

Sign In for Pricing
View Details