Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL3A1 Peptide - N-terminal region

COL3A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDS4A

UniProt

P02461

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL3A1 Rabbit Polyclonal Antibody (orb589613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000081.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-3-nitrophenol
TRC-C374595-1G 1 g

4-Chloro-3-nitrophenol

Sign In for Pricing
View Details
Germacrone (>90%)
TRC-G367755-10MG 10 mg

Germacrone (>90%)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB511859 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
PAP2D (PLPPR5) (Center) Rabbit Polyclonal Antibody
AP53160PU-N 400 µL

PAP2D (PLPPR5) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPIG Polyclonal Antibody
E-AB-90017-01 60 µL

PPIG Polyclonal Antibody

Sign In for Pricing
View Details
PPIG Polyclonal Antibody
E-AB-90017-02 120 µL

PPIG Polyclonal Antibody

Sign In for Pricing
View Details