Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL3A1 Peptide - N-terminal region

COL3A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDS4A

UniProt

P02461

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL3A1 Rabbit Polyclonal Antibody (orb589613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000081.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Morpholineethanesulfonic Acid Hydrate
TRC-M723880-500G 500 g

4-Morpholineethanesulfonic Acid Hydrate

Sign In for Pricing
View Details
SPHK2 Polyclonal Antibody
E-AB-10958-01 20 µL

SPHK2 Polyclonal Antibody

Sign In for Pricing
View Details
SPHK2 Polyclonal Antibody
E-AB-10958-02 60 µL

SPHK2 Polyclonal Antibody

Sign In for Pricing
View Details
SPHK2 Polyclonal Antibody
E-AB-10958-03 120 µL

SPHK2 Polyclonal Antibody

Sign In for Pricing
View Details
SPHK2 Polyclonal Antibody
E-AB-10958-04 200 µL

SPHK2 Polyclonal Antibody

Sign In for Pricing
View Details
Galectin 9 Recombinant Rabbit monoclonal Antibody
HA750810 100 µL

Galectin 9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details