Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSS Peptide - middle region

CTSS Peptide - middle region

Product Specifications

UniProt

P25774

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSS Rabbit Polyclonal Antibody (orb589762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001186668.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZYG11B siRNA (Human)
MBS8217588-01 15 nmol

ZYG11B siRNA (Human)

Sign In for Pricing
View Details
ZYG11B siRNA (Human)
MBS8217588-02 30 nmol

ZYG11B siRNA (Human)

Sign In for Pricing
View Details
ZYG11B siRNA (Human)
MBS8217588-03 5x 30 nmol

ZYG11B siRNA (Human)

Sign In for Pricing
View Details
ABCA10 CRISPR Knock Out 293T Cell Line (Human)
11009141 1x 10^6 Cells / 1.0 mL

ABCA10 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-SRD5A1 Antibody Picoband®, FITC Conjugate
A03464-2-FITC 100 µg/Vial

Anti-SRD5A1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Ccdc186 Mouse shRNA Plasmid (Locus ID 213993)
TR506397 1 Kit

Ccdc186 Mouse shRNA Plasmid (Locus ID 213993)

Sign In for Pricing
View Details