Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSS Peptide - middle region

CTSS Peptide - middle region

Product Specifications

UniProt

P25774

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSS Rabbit Polyclonal Antibody (orb589762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001186668.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb13 Mouse shRNA Plasmid (Locus ID 246083)
TL519654 1 Kit

Defb13 Mouse shRNA Plasmid (Locus ID 246083)

Sign In for Pricing
View Details
BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (FITC) discontinued
032607-FITC 200 µL

BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) ARGE Polyclonal Antibody
MBS7169765 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) ARGE Polyclonal Antibody

Sign In for Pricing
View Details
ROR2 Rabbit pAb
E45R25952N-50 50 µL

ROR2 Rabbit pAb

Sign In for Pricing
View Details
Octahydro-1H-pyrrolo[1,2-a][1,4]diazepine-1,5-dione
KHA75716-01 50 mg

Octahydro-1H-pyrrolo[1,2-a][1,4]diazepine-1,5-dione

Sign In for Pricing
View Details
Octahydro-1H-pyrrolo[1,2-a][1,4]diazepine-1,5-dione
KHA75716-02 0.5 g

Octahydro-1H-pyrrolo[1,2-a][1,4]diazepine-1,5-dione

Sign In for Pricing
View Details