Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Peptide - C-terminal region

SORT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NT3, Gp95, NTR3, LDLCQ6

UniProt

Q99523

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORT1 Rabbit Polyclonal Antibody (orb589765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001192157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMH1 Antibody - N-terminal region
MBS3218247-01 0.1 mL

ARMH1 Antibody - N-terminal region

Sign In for Pricing
View Details
ARMH1 Antibody - N-terminal region
MBS3218247-02 5x 0.1 mL

ARMH1 Antibody - N-terminal region

Sign In for Pricing
View Details
MCM6 (Minichromosome Maintenance Complex Component 6, MCG40308, Mis5, P105MCM) (MaxLight 550)
248594-ML550 100 µL

MCM6 (Minichromosome Maintenance Complex Component 6, MCG40308, Mis5, P105MCM) (MaxLight 550)

Sign In for Pricing
View Details
N-Methyl gatifloxacin
282416-01 1 mg

N-Methyl gatifloxacin

Sign In for Pricing
View Details
N-Methyl gatifloxacin
282416-02 2 mg

N-Methyl gatifloxacin

Sign In for Pricing
View Details
N-Methyl gatifloxacin
282416-03 5 mg

N-Methyl gatifloxacin

Sign In for Pricing
View Details