SORT1 Peptide - C-terminal region
SORT1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NT3, Gp95, NTR3, LDLCQ6
UniProt
Q99523
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SORT1 Rabbit Polyclonal Antibody (orb589765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001192157.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog