Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Peptide - C-terminal region

SORT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NT3, Gp95, NTR3, LDLCQ6

UniProt

Q99523

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORT1 Rabbit Polyclonal Antibody (orb589765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001192157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DURAN Silicone lid set S/M/L cyan
BOT1244 1 Each

DURAN Silicone lid set S/M/L cyan

Sign In for Pricing
View Details
Rabbit Polyclonal carabin Antibody [DyLight 550]
NBP1-76807R 0.1 mL

Rabbit Polyclonal carabin Antibody [DyLight 550]

Sign In for Pricing
View Details
ELISA Kit For Major vault protein
E1071c 96 Tests

ELISA Kit For Major vault protein

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)
MBS1136415-01 0.02 mg (E-Coli)

Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)
MBS1136415-02 0.1 mg (E-Coli)

Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)
MBS1136415-03 0.02 mg (Yeast)

Recombinant Xanthobacter autotrophicus Cytidylate kinase (cmk)

Sign In for Pricing
View Details