Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRPK1 Peptide - middle region

SRPK1 Peptide - middle region

Product Specifications

Product Name Alternative

SFRSK1

UniProt

Q96SB4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRPK1 Rabbit Polyclonal Antibody (orb589767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003128.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYR Reagent
V0251 00010 10 mL

PYR Reagent

Sign In for Pricing
View Details
Recombinant Dopa Decarboxylase (DDC)
SIPG788Mu01-01 10 µg

Recombinant Dopa Decarboxylase (DDC)

Sign In for Pricing
View Details
Recombinant Dopa Decarboxylase (DDC)
SIPG788Mu01-02 50 µg

Recombinant Dopa Decarboxylase (DDC)

Sign In for Pricing
View Details
Recombinant Dopa Decarboxylase (DDC)
SIPG788Mu01-03 200 µg

Recombinant Dopa Decarboxylase (DDC)

Sign In for Pricing
View Details
Recombinant Dopa Decarboxylase (DDC)
SIPG788Mu01-04 1 mg

Recombinant Dopa Decarboxylase (DDC)

Sign In for Pricing
View Details
Recombinant Dopa Decarboxylase (DDC)
SIPG788Mu01-05 5 mg

Recombinant Dopa Decarboxylase (DDC)

Sign In for Pricing
View Details