SRPK1 Peptide - middle region
SRPK1 Peptide - middle region
Product Specifications
Product Name Alternative
SFRSK1
UniProt
Q96SB4
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRPK1 Rabbit Polyclonal Antibody (orb589767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003128.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0045751-01 10 µg
Recombinant Adaptor Protein Phosphotyrosine Interaction PH Domain And leucine Zipper Containing Protein 1 (APPL1)
Sign In for Pricing
View Details TRV-0045751-02 50 µg
Recombinant Adaptor Protein Phosphotyrosine Interaction PH Domain And leucine Zipper Containing Protein 1 (APPL1)
Sign In for Pricing
View Details TRV-0045751-03 100 µg
Recombinant Adaptor Protein Phosphotyrosine Interaction PH Domain And leucine Zipper Containing Protein 1 (APPL1)
Sign In for Pricing
View Details TRV-0045751-04 200 µg
Recombinant Adaptor Protein Phosphotyrosine Interaction PH Domain And leucine Zipper Containing Protein 1 (APPL1)
Sign In for Pricing
View Details TRV-0045751-05 500 µg
Recombinant Adaptor Protein Phosphotyrosine Interaction PH Domain And leucine Zipper Containing Protein 1 (APPL1)
Sign In for Pricing
View Details