QKI Peptide - middle region
QKI Peptide - middle region
Product Specifications
Product Name Alternative
QK, Hqk, QK1, QK3, hqkI
UniProt
Q96PU8
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with QKI Rabbit Polyclonal Antibody (orb589785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006766.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682958-500 1x 500 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
EA101247 1x 48 Well (Pre-Coated)
Human IL-4 HS ELISA Kit, 1 x 48-well (pre-coated)
Sign In for Pricing
View Details 
