Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK1 Peptide - middle region

KLK1 Peptide - middle region

Product Specifications

Product Name Alternative

HK1, KLKR, Klk6

UniProt

P06870

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK1 Rabbit Polyclonal Antibody (orb589787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002248.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Col4a3 Rat shRNA Plasmid (Locus ID 363265)
TL708983 1 Kit

Col4a3 Rat shRNA Plasmid (Locus ID 363265)

Sign In for Pricing
View Details
SLAMF6 ORF Vector (Human) (pORF)
43855011 1.0 µg DNA

SLAMF6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-NQO1 Antibody Picoband® (APC Conjugate)
PB9497-APC 100 µg/Vial

Anti-NQO1 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
HIST1H1A Rabbit pAb (APR29023N)
APR29023N-01 50 µL

HIST1H1A Rabbit pAb (APR29023N)

Sign In for Pricing
View Details
HIST1H1A Rabbit pAb (APR29023N)
APR29023N-02 100 µL

HIST1H1A Rabbit pAb (APR29023N)

Sign In for Pricing
View Details
HIST1H1A Rabbit pAb (APR29023N)
APR29023N-03 200 µL

HIST1H1A Rabbit pAb (APR29023N)

Sign In for Pricing
View Details