Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK1 Peptide - middle region

KLK1 Peptide - middle region

Product Specifications

Product Name Alternative

HK1, KLKR, Klk6

UniProt

P06870

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK1 Rabbit Polyclonal Antibody (orb589787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002248.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MARCH5 Antibody
MBS8222262-01 0.03 mL

Anti-MARCH5 Antibody

Sign In for Pricing
View Details
Anti-MARCH5 Antibody
MBS8222262-02 0.05 mL

Anti-MARCH5 Antibody

Sign In for Pricing
View Details
Anti-MARCH5 Antibody
MBS8222262-03 0.1 mL

Anti-MARCH5 Antibody

Sign In for Pricing
View Details
Anti-MARCH5 Antibody
MBS8222262-04 0.2 mL

Anti-MARCH5 Antibody

Sign In for Pricing
View Details
Anti-MARCH5 Antibody
MBS8222262-05 5x 0.2 mL

Anti-MARCH5 Antibody

Sign In for Pricing
View Details
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
307307 100 µL

ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1

Sign In for Pricing
View Details