Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1 Peptide - middle region

ST6GAL1 Peptide - middle region

Product Specifications

Product Name Alternative

ST6N, SIAT1, ST6GalI

UniProt

P15907

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ST6GAL1 Rabbit Polyclonal Antibody (orb589789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003023.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bnc2 3'UTR Luciferase Stable Cell Line
TU201373 1.0 mL

Bnc2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal KLHL24 Antibody
NBP3-05979-50ul 50 µL

Rabbit Polyclonal KLHL24 Antibody

Sign In for Pricing
View Details
HBXIP Protein Vector (Human) (pPB-N-His)
PV019278 500 ng

HBXIP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal XPB Antibody [Alexa Fluor 647]
NB100-61059AF647 0.1 mL

Rabbit Polyclonal XPB Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse Transcription factor RelB (RELB) Elisa Kit
EK731546 96 Well

Mouse Transcription factor RelB (RELB) Elisa Kit

Sign In for Pricing
View Details
RELB Peptide
MBS3231913-01 0.1 mg

RELB Peptide

Sign In for Pricing
View Details