ST6GAL1 Peptide - middle region
ST6GAL1 Peptide - middle region
Product Specifications
Product Name Alternative
ST6N, SIAT1, ST6GalI
UniProt
P15907
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ST6GAL1 Rabbit Polyclonal Antibody (orb589789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003023.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB10105-Dylight550 100 µg
Anti-TREX2 Antibody Picoband® (Dylight550 Conjugate)
Sign In for Pricing
View Details 
GTR10361037 96 Well
Rat Arf GAP with GTPase, ANK repeat and PH domain containing protein 11 (AGAP11) ELISA Kit
Sign In for Pricing
View Details IHUSTRAILR1RLY10UG 10 µg
Human Soluble TRAIL Receptor-1 Recombinant Protein Lyophilized 10UG
Sign In for Pricing
View Details