Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb589792) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_110379.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGM4 discontinued
395331 200 µL

TGM4 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal OVGP1 Antibody [DyLight 550]
NBP1-76939R 0.1 mL

Rabbit Polyclonal OVGP1 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) WDP Polyclonal Antibody
MBS9003980 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) WDP Polyclonal Antibody

Sign In for Pricing
View Details
Methyl 6-methyl-1H-indazole-5-carboxylate
CHC40521-01 100 mg

Methyl 6-methyl-1H-indazole-5-carboxylate

Sign In for Pricing
View Details
Methyl 6-methyl-1H-indazole-5-carboxylate
CHC40521-02 1 g

Methyl 6-methyl-1H-indazole-5-carboxylate

Sign In for Pricing
View Details
DOPG, DOPC, Chol, NBD ATP Liposomes (20:50:29:1)
MPL1127K Each

DOPG, DOPC, Chol, NBD ATP Liposomes (20:50:29:1)

Sign In for Pricing
View Details