Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb589792) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_110379.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fgl1 Pre-designed siRNA Set B
SI104917B 1 Each

Mouse Fgl1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial
orb3007625-01 20 µg

Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial

Sign In for Pricing
View Details
Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial
orb3007625-02 100 µg

Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial

Sign In for Pricing
View Details
Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial
orb3007625-03 1 mg

Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial

Sign In for Pricing
View Details
9-[ (4,4,5,5,5-Pentafluoropentyl) thio]nonanol
PC540084 1 Each

9-[ (4,4,5,5,5-Pentafluoropentyl) thio]nonanol

Sign In for Pricing
View Details
Tns4 siRNA Oligos set (Rat)
47270176 3x 5 nmol

Tns4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details