Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMACHC Peptide - C-terminal region

MMACHC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CblC

UniProt

Q9Y4U1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMACHC Rabbit Polyclonal Antibody (orb589796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056321.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHD8 sgRNA gene knockout kit - Lentiviral human CHD8 sgRNA gene knockout kit (100)
GTR15394747 1 Vial

Lentiviral human CHD8 sgRNA gene knockout kit - Lentiviral human CHD8 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Embramine
TRC-E521005-1G 1 g

Embramine

Sign In for Pricing
View Details
NFIC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8171R-BF594 100 µL

NFIC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Myc-Tag Antibody
MBS7115610-01 0.05 mg

Myc-Tag Antibody

Sign In for Pricing
View Details
Myc-Tag Antibody
MBS7115610-02 0.1 mg

Myc-Tag Antibody

Sign In for Pricing
View Details
Myc-Tag Antibody
MBS7115610-03 5x 0.1 mg

Myc-Tag Antibody

Sign In for Pricing
View Details