Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMACHC Peptide - C-terminal region

MMACHC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CblC

UniProt

Q9Y4U1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMACHC Rabbit Polyclonal Antibody (orb589796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056321.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0558605 3x 1.0 µg

DAAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
AFP sgRNA CRISPR Lentivector (Human) (Target 1)
K0055702 1.0 µg DNA

AFP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Hsa-miR-1343-3p miRNA Antagomir
orb1914800-01 10 nmol

Hsa-miR-1343-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1343-3p miRNA Antagomir
orb1914800-02 20 nmol

Hsa-miR-1343-3p miRNA Antagomir

Sign In for Pricing
View Details
HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (APC) discontinued
036691-APC 200 µL

HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (APC) discontinued

Sign In for Pricing
View Details
Clostridium difficile Toxoid A protein
30-1861 500 ug

Clostridium difficile Toxoid A protein

Sign In for Pricing
View Details