Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLNK Peptide - N-terminal region

BLNK Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bca, AGM4, BASH, LY57, SLP65, BLNK-S, SLP-65

UniProt

Q8WV28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BLNK Rabbit Polyclonal Antibody (orb589801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001107566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody
PA85498HU-01 50 µg

Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody
PA85498HU-02 100 µg

Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody
PA85498HU-03 500 µg

Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody
PA85498HU-04 1 mg

Rabbit Anti-Human p53 (phospho Ser37) Polyclonal Antibody

Sign In for Pricing
View Details
Dibenzothiophene-2-ol
TRC-D417345-500MG 500 mg

Dibenzothiophene-2-ol

Sign In for Pricing
View Details
TSPYL1 siRNA (Human)
MBS8228237-01 15 nmol

TSPYL1 siRNA (Human)

Sign In for Pricing
View Details