Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLNK Peptide - N-terminal region

BLNK Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bca, AGM4, BASH, LY57, SLP65, BLNK-S, SLP-65

UniProt

Q8WV28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BLNK Rabbit Polyclonal Antibody (orb589801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001107566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erg sgRNA CRISPR Lentivector (Rat) (Target 2)
K6944203 1.0 µg DNA

Erg sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Claudin 10 Cell-Based ELISA Kit
CB5142 1 Kit

Claudin 10 Cell-Based ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C16orf46 homolog
MBS1372135-01 0.02 mg (E-Coli)

Recombinant Rat Uncharacterized protein C16orf46 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C16orf46 homolog
MBS1372135-02 0.02 mg (Yeast)

Recombinant Rat Uncharacterized protein C16orf46 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C16orf46 homolog
MBS1372135-03 0.1 mg (E-Coli)

Recombinant Rat Uncharacterized protein C16orf46 homolog

Sign In for Pricing
View Details
Recombinant Rat Uncharacterized protein C16orf46 homolog
MBS1372135-04 0.1 mg (Yeast)

Recombinant Rat Uncharacterized protein C16orf46 homolog

Sign In for Pricing
View Details