Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG14 Peptide - middle region

ATG14 Peptide - middle region

Product Specifications

Product Name Alternative

ATG14L, BARKOR, KIAA0831

UniProt

Q6ZNE5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG14 Rabbit Polyclonal Antibody (orb589805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055739.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200R1 Antibody (C-term) Blocking Peptide
MBS9221383-01 0.5 mg

CD200R1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
CD200R1 Antibody (C-term) Blocking Peptide
MBS9221383-02 5x 0.5 mg

CD200R1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Multiplex Assay Kit for Lactoferrin (LTF), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026979 96 Tests

Multiplex Assay Kit for Lactoferrin (LTF), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
UTS2 Antibody
orb518299-01 50 μL

UTS2 Antibody

Sign In for Pricing
View Details
UTS2 Antibody
orb518299-02 100 µL

UTS2 Antibody

Sign In for Pricing
View Details
GRHPR Human Gene Knockout Kit (CRISPR)
KN400963 1 Kit

GRHPR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details