RDH5 Peptide - middle region
RDH5 Peptide - middle region
Product Specifications
Product Name Alternative
RDH1, 9cRDH, SDR9C5, HSD17B9
UniProt
Q92781
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RDH5 Rabbit Polyclonal Antibody (orb589541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001186700.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGFRVLASCLTPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVEMHV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
