TGFBR3 Peptide - middle region
TGFBR3 Peptide - middle region
Product Specifications
Product Name Alternative
BGCAN, betaglycan
UniProt
Q03167
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TGFBR3 Rabbit Polyclonal Antibody (orb589559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001182612.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B286660-50MG 50 mg
(R)-5-(3-(Benzyloxy)-4-hydroxybenzyl)dihydrofuran-2(3H)-one
Sign In for Pricing
View Details 
LY424760 100 µg
Vitamin D Receptor (VDR) (NM_000376) Human Over-expression Lysate
Sign In for Pricing
View Details ![HDAC9 Mouse Monoclonal Antibody [Clone ID: OTI7G9]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907d0d/imageurl/cf805392.webp)