Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Befiradol 50mg
A21189-50 50 mg

Befiradol 50mg

Sign In for Pricing
View Details
Recombinant Human CD158a/KIR2DL1 Protein, C-His
E55P3582 50 µg

Recombinant Human CD158a/KIR2DL1 Protein, C-His

Sign In for Pricing
View Details
Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit
MBS9319124-01 48 Well

Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit
MBS9319124-02 96 Well

Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit
MBS9319124-03 5x 96 Well

Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit
MBS9319124-04 10x 96 Well

Mouse Repressor of RNA polymerase III transcription MAF1 homolog, MAF1 ELISA Kit

Sign In for Pricing
View Details