Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BXDC5 (m) -PR
sc-105132-PR 10 µM - 20 µL

BXDC5 (m) -PR

Sign In for Pricing
View Details
Ethyl 7-Oxoheptanoate
OR1013223-01 1 g

Ethyl 7-Oxoheptanoate

Sign In for Pricing
View Details
Ethyl 7-Oxoheptanoate
OR1013223-02 5 g

Ethyl 7-Oxoheptanoate

Sign In for Pricing
View Details
Ethyl 7-Oxoheptanoate
OR1013223-03 25 g

Ethyl 7-Oxoheptanoate

Sign In for Pricing
View Details
C9orf98 antibody
MBS9413833-01 0.1 mL

C9orf98 antibody

Sign In for Pricing
View Details
C9orf98 antibody
MBS9413833-02 5x 0.1 mL

C9orf98 antibody

Sign In for Pricing
View Details