Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Saa1 Mouse qPCR Primer Pair (NM_009117)
MP215294 200 Reactions

Saa1 Mouse qPCR Primer Pair (NM_009117)

Sign In for Pricing
View Details
Fam26d 3'UTR Lenti-reporter-Luc Vector
19988084 1.0 µg

Fam26d 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated
orb1674775-01 20 µg

Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated
orb1674775-02 100 µg

Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated
orb1674775-03 1 mg

Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated

Sign In for Pricing
View Details
MLN
CSB-CL014638HU 10 μg Plasmid + 200 μL Glycerol

MLN

Sign In for Pricing
View Details