Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4'-Dibromobiphenyl 98%
D09120-01 25 g

4,4'-Dibromobiphenyl 98%

Sign In for Pricing
View Details
4,4'-Dibromobiphenyl 98%
D09120-02 100 g

4,4'-Dibromobiphenyl 98%

Sign In for Pricing
View Details
4,4'-Dibromobiphenyl 98%
D09120-03 500 g

4,4'-Dibromobiphenyl 98%

Sign In for Pricing
View Details
MINA Polyclonal Antibody, Biotin Conjugated
A66065-050 50 µL

MINA Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
SEPT12 Antibody
MBS7000744-01 0.05 mg

SEPT12 Antibody

Sign In for Pricing
View Details
SEPT12 Antibody
MBS7000744-02 0.1 mg

SEPT12 Antibody

Sign In for Pricing
View Details