Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4833423E24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10564114 3x 1.0 µg

4833423E24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Thyroxine-Binding Globulin (TBG) Antibody
11601-05011 150 µg

Human Thyroxine-Binding Globulin (TBG) Antibody

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 14 (TNFSF14) ELISA Kit
JL33193-01 48 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 14 (TNFSF14) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 14 (TNFSF14) ELISA Kit
JL33193-02 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 14 (TNFSF14) ELISA Kit

Sign In for Pricing
View Details
FITC*Polyclonal  Rabbit Anti-Horse IgG(h+l)
CE30620-01 1 mL

FITC*Polyclonal Rabbit Anti-Horse IgG(h+l)

Sign In for Pricing
View Details
FITC*Polyclonal  Rabbit Anti-Horse IgG(h+l)
CE30620-02 10 mL

FITC*Polyclonal Rabbit Anti-Horse IgG(h+l)

Sign In for Pricing
View Details