Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - N-terminal region

MSR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSR1 Rabbit Polyclonal Antibody (orb589694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRGAP2 Rabbit pAb
A19512 20 µL

SRGAP2 Rabbit pAb

Sign In for Pricing
View Details
Afridol Blue
MBS5779326 Inquire

Afridol Blue

Sign In for Pricing
View Details
RFWD3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38878111 3x 1.0 µg

RFWD3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ATP2A3 Antibody - middle region
ARP46580_P050-25UL 25 µL

ATP2A3 Antibody - middle region

Sign In for Pricing
View Details
PRSS23 (Protease (Serine 23) Guinea Pig ELISA Kit
G4883 96 Tests

PRSS23 (Protease (Serine 23) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Galectin 12 (GAL12)
MBS2113072-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Galectin 12 (GAL12)

Sign In for Pricing
View Details