Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNGA3 Peptide - middle region

CNGA3 Peptide - middle region

Product Specifications

Product Name Alternative

CNG3, ACHM2, CCNC1, CCNCa, CNCG3, CCNCalpha

UniProt

Q16281

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNGA3 Rabbit Polyclonal Antibody (orb589735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001073347.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVFYNWYLLICR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN1 (NM_001135040) Human Over-expression Lysate
LY427531 100 µg

DCTN1 (NM_001135040) Human Over-expression Lysate

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Recombinant Protein
TP313132-B 20 µg

HSD17B13 (NM_178135) Human Recombinant Protein

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL
BNC882877-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EEF1A1 (NM_001402) Human Recombinant Protein
TP309697 20 µg

EEF1A1 (NM_001402) Human Recombinant Protein

Sign In for Pricing
View Details
FKBP9 Human Gene Knockout Kit (CRISPR)
KN422307 1 Kit

FKBP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB614685 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details