Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNGA3 Peptide - middle region

CNGA3 Peptide - middle region

Product Specifications

Product Name Alternative

CNG3, ACHM2, CCNC1, CCNCa, CNCG3, CCNCalpha

UniProt

Q16281

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNGA3 Rabbit Polyclonal Antibody (orb589735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001073347.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVFYNWYLLICR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ENGASE activation kit by CRISPRa
GA112135 1 Kit

Human ENGASE activation kit by CRISPRa

Sign In for Pricing
View Details
Prune homolog 2 (PRUNE2) Rabbit Polyclonal Antibody
TA362141 100 µL

Prune homolog 2 (PRUNE2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit
E-CL-H1005-01 24 Tests

Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit

Sign In for Pricing
View Details
Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit
E-CL-H1005-02 48 Tests

Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit

Sign In for Pricing
View Details
Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit
E-CL-H1005-03 96 Tests

Human NFE2L2 (Nuclear Factor, Erythroid Derived 2, Like 2) CLIA Kit

Sign In for Pricing
View Details
Human GNGT1 activation kit by CRISPRa
GA101863 1 Kit

Human GNGT1 activation kit by CRISPRa

Sign In for Pricing
View Details