Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL40 Peptide - N-terminal region

MRPL40 Peptide - N-terminal region

Product Specifications

Product Name Alternative

URIM, L40mt, NLVCF, MRPL22, MRP-L22, MRP-L40

UniProt

P15927

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL40 Rabbit Polyclonal Antibody (orb589758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (S214) Antibody
KC-44298-01 50 μL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-02 100 µL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-03 1 mL

Tau (S214) Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Radixin Recombinant Rabbit Monoclonal Antibody [SC06-22]
ET1610-41 100 µL

Radixin Recombinant Rabbit Monoclonal Antibody [SC06-22]

Sign In for Pricing
View Details