MRPL40 Peptide - N-terminal region
MRPL40 Peptide - N-terminal region
Product Specifications
Product Name Alternative
URIM, L40mt, NLVCF, MRPL22, MRP-L22, MRP-L40
UniProt
P15927
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPL40 Rabbit Polyclonal Antibody (orb589758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001273005.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CMPK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]](https://cdn.genprice.uk/products/937/6868c367994c49e6dc3f63df/imageurl/ta505389bm.webp)
TA505389BM 100 µL
CMPK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
Sign In for Pricing
View Details 
LC431086 20 µg
LOC728392 (NM_001162371) Human Over-expression Lysate
Sign In for Pricing
View Details 