RND3 Peptide - middle region
RND3 Peptide - middle region
Product Specifications
Product Name Alternative
ARHE, Rho8, RhoE, memB
UniProt
P61587
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RND3 Rabbit Polyclonal Antibody (orb589763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001241667.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HK200575 1 Kit
Activin A Receptor Type IC (ACVR1C) Human qPCR Template Standard (NM_145259)
Sign In for Pricing
View Details 
834800 175 Pack (7 Label (s) x 25 Card)
DATE INSPECTION LABELS 27 Dia 25 B-7541 Inspection & Calibration Labels
Sign In for Pricing
View Details 
12232141 1x 10^6 Cells / 1.0 mL
AQR CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details