Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBAG9 Peptide - middle region

EBAG9 Peptide - middle region

Product Specifications

Product Name Alternative

EB9, PDAF

UniProt

O00559

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EBAG9 Rabbit Polyclonal Antibody (orb589784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265867.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGL (NM_000643) Human Over-expression Lysate
LC424592 20 µg

AGL (NM_000643) Human Over-expression Lysate

Sign In for Pricing
View Details
Dibutyl 4-Hydroxybutyl Phosphate
TRC-D429405-50MG 50 mg

Dibutyl 4-Hydroxybutyl Phosphate

Sign In for Pricing
View Details
HER2 / ErbB2 Recombinant Rabbit Monoclonal Antibody [PD00-99]
HA721210 100 µL

HER2 / ErbB2 Recombinant Rabbit Monoclonal Antibody [PD00-99]

Sign In for Pricing
View Details
Lithium Iodide Hydrate
TRC-L469339-2.5G 2.5 g

Lithium Iodide Hydrate

Sign In for Pricing
View Details
c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody
AP02335PU-N 100 µL

c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Actl6b Mouse Gene Knockout Kit (CRISPR)
KN500780 1 Kit

Actl6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details