Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBAG9 Peptide - middle region

EBAG9 Peptide - middle region

Product Specifications

Product Name Alternative

EB9, PDAF

UniProt

O00559

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EBAG9 Rabbit Polyclonal Antibody (orb589784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265867.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apod Mouse Gene Knockout Kit (CRISPR)
KN501420 1 Kit

Apod Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin K (CTSK) (NM_000396) Human Over-expression Lysate
LY424745 100 µg

Cathepsin K (CTSK) (NM_000396) Human Over-expression Lysate

Sign In for Pricing
View Details
UNC45A Human Gene Knockout Kit (CRISPR)
KN400151 1 Kit

UNC45A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR566331 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
DNAJA2 (NM_005880) Human Over-expression Lysate
LC401779 20 µg

DNAJA2 (NM_005880) Human Over-expression Lysate

Sign In for Pricing
View Details
Lsm1 (NM_026032) Mouse Tagged ORF Clone
MG200775 10 µg

Lsm1 (NM_026032) Mouse Tagged ORF Clone

Sign In for Pricing
View Details